Structure of PDB 3d38 Chain M
Receptor sequence
| >3d38M (length=323) Species: 1079 (Blastochloris viridis) [Search protein sequence] |
| ADYQTIYTQIQARGPHITVSGEWGDNDRVGKPFYSYWLGKIGDAQIGPIY LGASGIAAFAFGSTAILIILFNMAAEVHFDPLQFFRQFFWLGLYPPKAQY GMGIPPLHDGGWWLMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAA AIFFVLCIGCIHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWH GFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRGTAVERAALFW RWTIGFNATIESVHRWGWFFSLMVMVSASVGILLTGTFVDNWYLWCVKHG AAPDYPAYLPATPDPASLPGAPK |
3D structure
| PDB | 3d38 Simple host-guest chemistry to modulate the process of concentration and crystallization of membrane proteins by detergent capture in a microfluidic device. | ||
| Chain | M | ||
| Resolution | 3.21 Å | ||
| 3D structure |
|
Enzymatic activity
| Enzyme Commision number | ? |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | BCB | M | G201 I204 G205 Y208 G209 | G201 I204 G205 Y208 G209 | |
| BS02 | BPB | M | Y208 G211 L212 | Y208 G211 L212 | |
| BS03 | UQ1 | M | F85 F89 | F85 F89 | |
| BS04 | FE2 | M | H217 E232 H264 | H217 E232 H264 | |
| BS05 | MQ9 | M | H217 A246 W250 I254 N257 A258 I260 V263 W266 | H217 A246 W250 I254 N257 A258 I260 V263 W266 | |
| BS06 | BCB | M | I177 H180 I181 L184 | I177 H180 I181 L184 | |
| BS07 | BCB | M | G62 M120 V155 L184 S188 F194 Y195 H200 S203 I204 Y208 M275 A278 I282 | G62 M120 V155 L184 S188 F194 Y195 H200 S203 I204 Y208 M275 A278 I282 | |
| BS08 | BPB | M | A58 F59 I66 S123 W127 F148 S271 | A58 F59 I66 S123 W127 F148 S271 | |
| BS09 | NS5 | M | L70 L114 G117 G159 C160 V173 F175 G176 I177 H180 | L70 L114 G117 G159 C160 V173 F175 G176 I177 H180 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0042314 | bacteriochlorophyll binding |
| GO:0045156 | electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity |
| GO:0046872 | metal ion binding |
