Structure of PDB 2x5u Chain M

Receptor sequence

>2x5uM (length=323) Species: 1079 (Blastochloris viridis)

ADYQTIYTQIQARGPHITVSGEWGDNDRVGKPFYSYWLGKIGDAQIGPIY
LGASGIAAFAFGSTAILIILFNMAAEVHFDPLQFFRQFFWLGLYPPKAQY
GMGIPPLHDGGWWLMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAA
AIFFVLCIGCIHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWH
GFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRGTAVERAALFW
RWTIGFNATIESVHRWGWFFSLMVMVSASVGILLTGTFVDNWYLWCVKHG
AAPDYPAYLPATPDPASLPGAPK

3D structure

• PDB: 2x5u Light-induced structural changes in a photosynthetic reaction center caught by Laue diffraction.
• Chain: M
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCB	M	G201 I204 G205 Y208	G201 I204 G205 Y208
BS02	BPB	M	Y208 G211 L212	Y208 G211 L212
BS03	BCB	M	I177 H180 I181 L184	I177 H180 I181 L184
BS04	BCB	M	M120 L124 F154 V155 L184 F194 Y195 H200 S203 I204 Y208 M275 A278 I282	M120 L124 F154 V155 L184 F194 Y195 H200 S203 I204 Y208 M275 A278 I282
BS05	BPB	M	F59 S123 W127 V131 N147 F148 S271 M275	F59 S123 W127 V131 N147 F148 S271 M275
BS06	FE2	M	H217 E232 H264	H217 E232 H264
BS07	MQ7	M	H217 T220 W250 F256 N257 A258 V263 W266	H217 T220 W250 F256 N257 A258 V263 W266

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:2x5u, PDBe:2x5u, PDBj:2x5u
• PDBsum: 2x5u
• PubMed: 20431017
• UniProt: P06010|RCEM_BLAVI Reaction center protein M chain (Gene Name=pufM)