Structure of PDB 2uws Chain M

Receptor sequence

>2uwsM (length=302) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

AEYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNP
FHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
HG

3D structure

PDB

2uws Ph Modulates the Quinone Position in the Photosynthetic Reaction Center from Rhodobacter Sphaeroides in the Neutral and Charge Separated States.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	M	G203 I206 A207 Y210 L214	G203 I206 A207 Y210 L214
BS02	BPH	M	Y210 L214 W252	Y210 L214 W252
BS03	BCL	M	H182 L183	H182 L183
BS04	BCL	M	L156 W157 T186 L196 F197 H202 S205 I206 L209 V276 G280 I284	L156 W157 T186 L196 F197 H202 S205 I206 L209 V276 G280 I284
BS05	FE	M	H219 E234 H266	H219 E234 H266
BS06	BPH	M	G63 A125 V126 W129 A149 F150 A153 T277	G63 A125 V126 W129 A149 F150 A153 T277
BS07	U10	M	H219 T222 A248 A249 W252 M256 N259 A260 T261 I265 W268	H219 T222 A248 A249 W252 M256 N259 A260 T261 I265 W268
BS08	SPO	M	F67 G71 W75 F105 W115 S119 M122 W157 L160 G161 W171 G178 H182	F67 G71 W75 F105 W115 S119 M122 W157 L160 G161 W171 G178 H182

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2uws, PDBe:2uws, PDBj:2uws
PDBsum	2uws
PubMed	17570397
UniProt	P0C0Y9\|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]