Structure of PDB 2rcr Chain M

Receptor sequence

>2rcrM (length=305) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

AEYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNP
FHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
HGMAP

3D structure

PDB

2rcr Structure of the membrane-bound protein photosynthetic reaction center from Rhodobacter sphaeroides.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	M	F195 A205 F206	F197 A207 F208
BS02	BPH	M	Y208 A211 L212 M216 W250	Y210 A213 L214 M218 W252
BS03	UQ	M	L51 L59 W127	L52 L60 W129
BS04	FE	M	H217 E232 H264	H219 E234 H266
BS05	BCL	M	L158 H180 L181 W183 T184	L160 H182 L183 W185 T186
BS06	BCL	M	L154 T184 F187 S188 L194 F195 H200 S203 I204 T275 G278 I282	L156 T186 F189 S190 L196 F197 H202 S205 I206 T277 G280 I284
BS07	BPH	M	S58 F66 W127 T131 F148 A271	S59 F67 W129 T133 F150 A273
BS08	UQ	M	L212 M216 T220 A243 W250 M254 F256 A258 T259 M260 I263 W266	L214 M218 T222 A245 W252 M256 F258 A260 T261 M262 I265 W268

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2rcr, PDBe:2rcr, PDBj:2rcr
PDBsum	2rcr
PubMed	2036404
UniProt	P0C0Y9\|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]