Structure of PDB 2qkk Chain M

Receptor sequence
>2qkkM (length=145) Species: 9606 (Homo sapiens) [Search protein sequence]
DFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEI
HAACKAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKE
VINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAK
3D structure
PDB2qkk Structure of Human RNase H1 Complexed with an RNA/DNA Hybrid: Insight into HIV Reverse Transcription
ChainM
Resolution3.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D145 G146 E186 N210 H264 D274
Catalytic site (residue number reindexed from 1) D8 G9 E49 N73 H127 D137
Enzyme Commision number 3.1.26.4: ribonuclease H.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M C148 S150 N151 R153 N182 E186 N210 M212 H260 G263 C11 S13 N14 R16 N45 E49 N73 M75 H123 G126
BS02 dna M N151 R179 T181 N182 Q183 F213 W221 W225 T232 S233 V238 I239 N240 N14 R42 T44 N45 Q46 F76 W84 W88 T95 S96 V101 I102 N103
BS03 CA M D145 D274 D8 D137
BS04 CA M D145 E186 N210 D8 E49 N73
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:2qkk, PDBe:2qkk, PDBj:2qkk
PDBsum2qkk
PubMed17964265
UniProtO60930|RNH1_HUMAN Ribonuclease H1 (Gene Name=RNASEH1)

[Back to BioLiP]