Structure of PDB 2qjk Chain M

Receptor sequence

>2qjkM (length=428) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

GIPHDHYEPRTGIEKWLHSRLPIVALAYDTIMIPTPRNLNWMWIWGVVLA
FCLVLQIVTGIVLAMHYTPHVDLAFASVEHIMRNVNGGFMLRYLHANGAS
LFFIAVYLHIFRGLYYGSYKAPREVTWIVGMLIYLAMMATAFMGYVLPWG
QMSFWGATVITGLFGAIPGIGHSIQTWLLGGPAVDNATLNRFFSLHYLLP
FVIAALVAIHIWAFHSTGNNNPTGVEVRRTSKAEAQKDTVPFWPYFIIKD
VFALAVVLLVFFAIVGFMPNYLGHPDNYIEANPLRTPAHIVPEWYFLPFY
AILRAFTADVWVVQIANFISFGIIDAKFFGVLAMFGAILVMALVPWLDTS
PVRSGRYRPMFKIYFWLLAADFVILTWVGAQQTTFPYDWISLIASAYWFA
YFLVILPILGAIEKPVAPPATIEEDFNA

3D structure

PDB

2qjk Inhibitor-complexed structures of the cytochrome bc1 from the photosynthetic bacterium Rhodobacter sphaeroides.

Chain

Resolution

3.1 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H217 N221 K251 D252 E295
Catalytic site (residue number reindexed from 1)	H215 N219 K249 D250 E293
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEM	M	W45 G48 L51 A52 H111 R114 R125 T128 W129 G132 M133 I135 H212 F216 N221	W43 G46 L49 A50 H109 R112 R123 T126 W127 G130 M131 I133 H210 F214 N219
BS02	HEM	M	Q58 G62 I63 Y69 R94 H97 A98 T142 G146 L149 P150 H198 Y199 P202	Q56 G60 I61 Y67 R92 H95 A96 T140 G144 L147 P148 H196 Y197 P200
BS03	SMA	M	F144 M145 G158 V161 I162 V293 P294 E295 F298 Y302 M336	F142 M143 G156 V159 I160 V291 P292 E293 F296 Y300 M334
BS04	LOP	M	M44 F113 Y117 Y118 R358 F374	M42 F111 Y115 Y116 R356 F372
BS05	ANJ	M	W45 V49 I213 F216 N221 F244 D252	W43 V47 I211 F214 N219 F242 D250

Gene Ontology

	Molecular Function
GO:0008121	ubiquinol-cytochrome-c reductase activity
GO:0009055	electron transfer activity
GO:0016491	oxidoreductase activity
GO:0046872	metal ion binding

	Biological Process
GO:0022904	respiratory electron transport chain
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0045275	respiratory chain complex III

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2qjk, PDBe:2qjk, PDBj:2qjk
PDBsum	2qjk
PubMed	18039651
UniProt	Q02761\|CYB_CERSP Cytochrome b (Gene Name=petB)

[Back to BioLiP]