Structure of PDB 2i5n Chain M

Receptor sequence

>2i5nM (length=323) Species: 1079 (Blastochloris viridis) [Search protein sequence]

ADYQTIYTQIQARGPHITVSGEWGDNDRVGKPFYSYWLGKIGDAQIGPIY
LGASGIAAFAFGSTAILIILFNMAAEVHFDPLQFFRQFFWLGLYPPKAQY
GMGIPPLHDGGWWLMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAA
AIFFVLCIGCIHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWH
GFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRGTAVERAALFW
RWTIGFNATIESVHRWGWFFSLMVMVSASVGILLTGTFVDNWYLWCVKHG
AAPDYPAYLPATPDPASLPGAPK

3D structure

PDB

2i5n Nanoliter microfluidic hybrid method for simultaneous screening and optimization validated with crystallization of membrane proteins.

Chain

Resolution

1.96 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FE2	M	H217 E232 H264	H217 E232 H264
BS02	BCB	M	G201 I204 G205 Y208 G209	G201 I204 G205 Y208 G209
BS03	BPB	M	Y208 G211 L212 W250 I254	Y208 G211 L212 W250 I254
BS04	MQ9	M	L213 H217 T220 A246 W250 I254 F256 N257 A258 I260 V263 W266	L213 H217 T220 A246 W250 I254 F256 N257 A258 I260 V263 W266
BS05	UQ1	M	F85 F89	F85 F89
BS06	BCB	M	I177 H180 I181 L184	I177 H180 I181 L184
BS07	BCB	M	G62 I66 M120 F154 V155 F194 Y195 H200 S203 I204 Y208 M275 A278 I282	G62 I66 M120 F154 V155 F194 Y195 H200 S203 I204 Y208 M275 A278 I282
BS08	BPB	M	A58 F59 I66 S123 W127 I144 N147 F148 S271	A58 F59 I66 S123 W127 I144 N147 F148 S271
BS09	NS5	M	I66 G117 T121 G159 C160 V173 F175 G176 H180	I66 G117 T121 G159 C160 V173 F175 G176 H180

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2i5n, PDBe:2i5n, PDBj:2i5n
PDBsum	2i5n
PubMed	17159147
UniProt	P06010\|RCEM_BLAVI Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]