Structure of PDB 2hh1 Chain M

Receptor sequence

>2hh1M (length=302) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

AEYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNP
FHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
HG

3D structure

PDB

2hh1 Brominated Lipids Identify Lipid Binding Sites on the Surface of the Reaction Center from Rhodobacter sphaeroides.

Chain

Resolution

2.55 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	M	I206 A207 Y210 L214	I206 A207 Y210 L214
BS02	BPH	M	Y210 L214 W252	Y210 L214 W252
BS03	PC9	M	S30 G31 W129	S30 G31 W129
BS04	FE	M	H219 E234 H266	H219 E234 H266
BS05	BCL	M	H182 L183	H182 L183
BS06	BCL	M	W66 L156 T186 N187 F189 L196 F197 H202 S205 I206 L209 Y210 V276 G280 I284	W66 L156 T186 N187 F189 L196 F197 H202 S205 I206 L209 Y210 V276 G280 I284
BS07	BPH	M	S59 G63 A125 W129 A149 F150 A153 T277	S59 G63 A125 W129 A149 F150 A153 T277
BS08	U10	M	M218 H219 T222 A248 A249 W252 M256 F258 N259 A260 I265 W268	M218 H219 T222 A248 A249 W252 M256 F258 N259 A260 I265 W268

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2hh1, PDBe:2hh1, PDBj:2hh1
PDBsum	2hh1
PubMed	17315985
UniProt	P0C0Y9\|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]