Structure of PDB 2gnu Chain M

Receptor sequence

>2gnuM (length=300) Species: 1063 (Cereibacter sphaeroides)

EYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIY
LGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPEY
GLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFL
SAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNPF
HGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAALF
WRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQNH

3D structure

• PDB: 2gnu Lipidic sponge phase crystallization of membrane proteins
• Chain: M
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	M	F197 G203 I206 A207 Y210 L214	F196 G202 I205 A206 Y209 L213
BS02	FE2	M	H219 E234 H266	H218 E233 H265
BS03	BPH	M	Y210 L214 W252	Y209 L213 W251
BS04	BCL	M	H182 L183	H181 L182
BS05	BCL	M	A153 L156 W157 T186 N187 F189 L196 F197 H202 S205 I206 L209 Y210 V276 G280 I284	A152 L155 W156 T185 N186 F188 L195 F196 H201 S204 I205 L208 Y209 V275 G279 I283
BS06	BPH	M	L64 F67 A125 W129 A149 F150 A153 T277	L63 F66 A124 W128 A148 F149 A152 T276
BS07	U10	M	M218 H219 T222 A249 W252 M256 F258 N259 A260 I265 W268	M217 H218 T221 A248 W251 M255 F257 N258 A259 I264 W267

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:2gnu, PDBe:2gnu, PDBj:2gnu
• PDBsum: 2gnu
• PubMed: 17005199
• UniProt: P0C0Y9|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)