Structure of PDB 2gmr Chain M

Receptor sequence

>2gmrM (length=297) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

QNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIYLG
SLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPEYGL
SFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFLSA
IWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNPFHG
LSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAALFWR
WTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN

3D structure

PDB

2gmr Proton uptake in the reaction center mutant L210DN from Rhodobacter sphaeroides via protonated water molecules.

Chain

Resolution

2.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	M	W66 H182 L183	W63 H179 L180
BS02	BCL	M	F197 I206 A207 Y210 L214	F194 I203 A204 Y207 L211
BS03	BPH	M	Y210 L214 M218 W252	Y207 L211 M215 W249
BS04	FE2	M	H219 E234 H266	H216 E231 H263
BS05	BCL	M	A153 L156 W157 T186 N187 F189 S190 L196 F197 H202 S205 I206 Y210 V276 G280 I284	A150 L153 W154 T183 N184 F186 S187 L193 F194 H199 S202 I203 Y207 V273 G277 I281
BS06	BPH	M	L60 G63 F67 W129 A149 F150 A153 A273 T277	L57 G60 F64 W126 A146 F147 A150 A270 T274
BS07	U10	M	M218 H219 T222 W252 M256 N259 A260 I265 W268	M215 H216 T219 W249 M253 N256 A257 I262 W265
BS08	SPN	M	F67 F68 I70 G71 W75 S119 F120 W157 F162 Y177 I179 H182	F64 F65 I67 G68 W72 S116 F117 W154 F159 Y174 I176 H179

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2gmr, PDBe:2gmr, PDBj:2gmr
PDBsum	2gmr
PubMed	17105193
UniProt	P0C0Y9\|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]