Structure of PDB 2eim Chain M

Receptor sequence

>2eimM (length=43) Species: 9913 (Bos taurus)

ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKS

3D structure

• PDB: 2eim A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
• Chain: M
• Resolution: 2.6 Å

Enzymatic activity

• Enzyme Commision number: 1.9.3.1: Transferred entry: 7.1.1.9.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DMU	M	L27 L28 G31 W32 Y35 H36	L27 L28 G31 W32 Y35 H36

Gene Ontology

Biological Process

• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen

Cellular Component

• GO:0045277 respiratory chain complex IV

External links

• PDB: RCSB:2eim, PDBe:2eim, PDBj:2eim
• PDBsum: 2eim
• PubMed: 17470809
• UniProt: P10175|COX8B_BOVIN Cytochrome c oxidase subunit 8B, mitochondrial (Gene Name=COX8B)