Structure of PDB 1xnr Chain M

Receptor sequence

>1xnrM (length=125) Species: 274 (Thermus thermophilus)

ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEA
EVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQ
RTRTNARTRKGPRKTVAGKKKAPRK

3D structure

• PDB: 1xnr Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
• Chain: M
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	K13 V17 Y23 G24 I25 G26 A28 R29 N77 I78 Y87 R88 R91 H92 L96 P97 V98 R99 G100 Q101 R102 T103 R104 T105 N106 A107 R108 T109 R110 K111 R114 K115 T116 V117 K120 R125 K126	K12 V16 Y22 G23 I24 G25 A27 R28 N76 I77 Y86 R87 R90 H91 L95 P96 V97 R98 G99 Q100 R101 T102 R103 T104 N105 A106 R107 T108 R109 K110 R113 K114 T115 V116 K119 R124 K125

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1xnr, PDBe:1xnr, PDBj:1xnr
• PDBsum: 1xnr
• PubMed: 15558050
• UniProt: P80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)