Structure of PDB 1vqm Chain M

Receptor sequence

>1vqmM (length=194) Species: 2238 (Haloarcula marismortui)

ARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKAR
SQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRV
AEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWI
CADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKA

3D structure

• PDB: 1vqm Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
• Chain: M
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	A1 S3 Y5 R9 E13 W25 Q29 R32 G35 A36 R39 R42 R45 L46 K48 R50 S51 Q52 K55 A56 Q58 R68 G70 S71 R73 K74 R75 R76 H77 K78 A79 G80 R81 R82 S83 K84 R85 Q86 T89 R90 T92 R93 R94 K95 D96 I97 R99 V100 R104 R107 F109 P110 N111 N116 G124 K127 D135 N137 H138 P139 A140 N143 W149 A156 D157 F160 R161 L163 G165 R168 N170 R171 K176 G177 K178 G179 E181 K182 R184 P185 S186 L187 R188 G191 K193 A194	A1 S3 Y5 R9 E13 W25 Q29 R32 G35 A36 R39 R42 R45 L46 K48 R50 S51 Q52 K55 A56 Q58 R68 G70 S71 R73 K74 R75 R76 H77 K78 A79 G80 R81 R82 S83 K84 R85 Q86 T89 R90 T92 R93 R94 K95 D96 I97 R99 V100 R104 R107 F109 P110 N111 N116 G124 K127 D135 N137 H138 P139 A140 N143 W149 A156 D157 F160 R161 L163 G165 R168 N170 R171 K176 G177 K178 G179 E181 K182 R184 P185 S186 L187 R188 G191 K193 A194

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1vqm, PDBe:1vqm, PDBj:1vqm
• PDBsum: 1vqm
• PubMed: 16285925
• UniProt: P60618|RL15E_HALMA Large ribosomal subunit protein eL15 (Gene Name=rpl15e)