Structure of PDB 1u3e Chain M

Receptor sequence

>1u3eM (length=174) Species: 10685 (Okubovirus SPO1)

MEWKDIKGYEGHYQVSNTGEVYSIKSGKTLKHQIPKDGYHRIGLFKGGKG
KTFQVHRLVAIHFCEGYEEGLVVDHKDGNKDNNLSTNLRWVTQKINVENQ
MSRGTLNVSKAQQIAKIKNQKPIIVISPDGIEKEYPSTKCACEELGLTRG
KVTDVLKGHRIHHKGYTFRYKLNG

3D structure

• PDB: 1u3e DNA Binding and Cleavage by the HNH Homing Endonuclease I-HmuI.
• Chain: M
• Resolution: 2.92 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	M	S23 S26 K31 Q33 F45 G48 Q93 K94 V97 L106 V108 Q112 K116 K121 S137 T138 K139 G150 T153 D154 K157 Y170	S23 S26 K31 Q33 F45 G48 Q93 K94 V97 L106 V108 Q112 K116 K121 S137 T138 K139 G150 T153 D154 K157 Y170
BS02	dna	M	N96 Q100 T105 N107 V108 A111 I114 A115 N119 T148 G150 K151 R160 H162 K164	N96 Q100 T105 N107 V108 A111 I114 A115 N119 T148 G150 K151 R160 H162 K164
BS03	dna	M	Y39 R41 K51 Q54 H56 R57 V72 V73 D74 H75 N96	Y39 R41 K51 Q54 H56 R57 V72 V73 D74 H75 N96
BS04	MN	M	D74 N96	D74 N96

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity
• GO:0016788 hydrolase activity, acting on ester bonds

Biological Process

• GO:0006314 intron homing

External links

• PDB: RCSB:1u3e, PDBe:1u3e, PDBj:1u3e
• PDBsum: 1u3e
• PubMed: 15313606
• UniProt: P34081|HMUI_BPSP1 DNA endonuclease I-HmuI