Structure of PDB 1nji Chain M

Receptor sequence

>1njiM (length=145) Species: 2238 (Haloarcula marismortui)

TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSG
FKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADY
VKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ

3D structure

• PDB: 1nji Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
• Chain: M
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	T1 K3 K4 K5 R6 R8 G9 R11 T12 H13 G14 G16 H18 K19 N20 R21 R22 G23 A24 G25 H26 R27 G28 G29 R30 G31 D32 R35 K37 H38 E39 F40 H41 L46 G47 K48 G50 F51 K52 R53 P54 Q55 K56 V57 D65 D70 E71 K107 L109 G110 A111 G112 Q113 R115 S126	T1 K3 K4 K5 R6 R8 G9 R11 T12 H13 G14 G16 H18 K19 N20 R21 R22 G23 A24 G25 H26 R27 G28 G29 R30 G31 D32 R35 K37 H38 E39 F40 H41 L46 G47 K48 G50 F51 K52 R53 P54 Q55 K56 V57 D65 D70 E71 K102 L104 G105 A106 G107 Q108 R110 S121

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1nji, PDBe:1nji, PDBj:1nji
• PDBsum: 1nji
• PubMed: 12860128
• UniProt: P12737|RL15_HALMA Large ribosomal subunit protein uL15 (Gene Name=rpl15)