Structure of PDB 1n36 Chain M

Receptor sequence
>1n36M (length=118) Species: 274 (Thermus thermophilus) [Search protein sequence]
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEA
EVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQ
RTRTNARTRKGPRKTVAG
3D structure
PDB1n36 Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
ChainM
Resolution3.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M R14 Y23 G24 I25 G26 A28 R29 R44 N77 R88 R91 H92 P97 R99 R102 T103 R104 T105 N106 A107 R108 T109 K111 K115 T116 R13 Y22 G23 I24 G25 A27 R28 R43 N76 R87 R90 H91 P96 R98 R101 T102 R103 T104 N105 A106 R107 T108 K110 K114 T115 PDBbind-CN: Kd=150uM
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1n36, PDBe:1n36, PDBj:1n36
PDBsum1n36
PubMed12464183
UniProtP80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)

[Back to BioLiP]