Structure of PDB 1m8v Chain M

Receptor sequence
>1m8vM (length=71) Species: 29292 (Pyrococcus abyssi) [Search protein sequence]
ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGE
VVKRYGKIVIRGDNVLAISPT
3D structure
PDB1m8v Crystal Structure of Pyrococcus abyssii Sm core and its Complex with RNA: Common Features of RNA-binding in Archaea and Eukarya
ChainM
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M P605 L606 D607 H610 Y634 P3 L4 D5 H8 Y32
BS02 U M H637 N639 R663 D665 H35 N37 R61 D63
BS03 U M L638 D665 L36 D63
Gene Ontology
Biological Process
GO:0000398 mRNA splicing, via spliceosome
Cellular Component
GO:0120114 Sm-like protein family complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1m8v, PDBe:1m8v, PDBj:1m8v
PDBsum1m8v
PubMed12409299
UniProtQ9V0Y8|RUXX_PYRAB Putative snRNP Sm-like protein (Gene Name=PYRAB06500)

[Back to BioLiP]