Structure of PDB 1m3x Chain M

Receptor sequence

>1m3xM (length=302) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

AEYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNP
FHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
HG

3D structure

PDB

1m3x Interactions between lipids and bacterial reaction centers determined by protein crystallography.

Chain

Resolution

2.55 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	M	H182 L183	H182 L183
BS02	BCL	M	G203 I206 A207 Y210	G203 I206 A207 Y210
BS03	BPH	M	Y210 L214 W252	Y210 L214 W252
BS04	FE	M	H219 E234 H266	H219 E234 H266
BS05	BCL	M	A153 L156 W157 T186 N187 S190 L196 F197 H202 S205 I206 Y210 G280 I284	A153 L156 W157 T186 N187 S190 L196 F197 H202 S205 I206 Y210 G280 I284
BS06	BPH	M	G63 F67 A125 W129 A149 F150 A153 A273 T277	G63 F67 A125 W129 A149 F150 A153 A273 T277
BS07	U10	M	M218 H219 T222 W252 M256 F258 N259 A260 T261 I265 W268	M218 H219 T222 W252 M256 F258 N259 A260 T261 I265 W268
BS08	SPO	M	F67 G71 W115 S119 W157 G161 F162 V175 H182	F67 G71 W115 S119 W157 G161 F162 V175 H182
BS09	CDL	M	G143 K144 H145 W148 W155 R267 W271 L278	G143 K144 H145 W148 W155 R267 W271 L278

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1m3x, PDBe:1m3x, PDBj:1m3x
PDBsum	1m3x
PubMed	12167672
UniProt	P0C0Y9\|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]