Structure of PDB 1l9b Chain M

Receptor sequence

>1l9bM (length=267) Species: 1063 (Cereibacter sphaeroides)

FSTLLGWFGNAQLGPIYLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAV
FLRDLFFFSLEPPAPEYGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTY
LRAQALGMGKHTAWAFLSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLD
WTNNFSLVHGNLFYNPFHGLSIAFLYGSALLFAMHGATILAVSRFGGERE
LEQIADRGTAAERAALFWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGI
LLSGTVVDNWYVWGQNH

3D structure

• PDB: 1l9b X-ray structure determination of the cytochrome c2: reaction center electron transfer complex from Rhodobacter sphaeroides.
• Chain: M
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	M	G203 I206 A207 Y210	G169 I172 A173 Y176
BS02	BPH	M	G63 A125 V126 W129 A149 F150 A153 A273	G29 A91 V92 W95 A115 F116 A119 A239
BS03	FE2	M	H219 E234 H266	H185 E200 H232
BS04	BCL	M	H182 L183	H148 L149
BS05	BCL	M	L156 W157 T186 N187 S190 L196 F197 H202 S205 I206 L209 Y210 T277 G280 I284	L122 W123 T152 N153 S156 L162 F163 H168 S171 I172 L175 Y176 T243 G246 I250
BS06	BPH	M	Y210 A213 L214 M218 W252 M256	Y176 A179 L180 M184 W218 M222
BS07	U10	M	M218 H219 T222 W252 F258 N259 A260 T261 M262 I265 W268	M184 H185 T188 W218 F224 N225 A226 T227 M228 I231 W234

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:1l9b, PDBe:1l9b, PDBj:1l9b
• PDBsum: 1l9b
• PubMed: 12051924
• UniProt: P0C0Y9|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)