Structure of PDB 1jzx Chain M |
>1jzxM (length=58) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] |
AKHPVPKKKTSKSKRDMRRSHHALTAPNLTECPQCHGKKLSHHICPNCGY YDGRQVLA |
|
PDB | 1jzx Structural basis for the interaction of antibiotics with the peptidyl transferase centre in eubacteria. |
Chain | M |
Resolution | 3.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
M |
H4 P7 K10 H43 |
H3 P6 K9 H42 |
|
|
|
|