Structure of PDB 1jgw Chain M

Receptor sequence

>1jgwM (length=302) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

AEYQNIFSQVQVRGPADLGMLEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNP
FHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
HG

3D structure

PDB

1jgw Individual interactions influence the crystalline order for membrane proteins.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	M	F90 H182 L183	F90 H182 L183
BS02	BPH	M	Y210 A213 L214	Y210 A213 L214
BS03	FE	M	H219 E234 H266	H219 E234 H266
BS04	BCL	M	A153 L156 W157 T186 N187 F189 L196 F197 H202 S205 I206 Y210 G280 I284	A153 L156 W157 T186 N187 F189 L196 F197 H202 S205 I206 Y210 G280 I284
BS05	BCL	M	G203 I206 A207 Y210	G203 I206 A207 Y210
BS06	BPH	M	F67 W129 A149 F150 A153 A273 T277	F67 W129 A149 F150 A153 A273 T277
BS07	U10	M	M218 H219 A248 A249 W252 F258 N259 A260 I265 W268	M218 H219 A248 A249 W252 F258 N259 A260 I265 W268
BS08	SPO	M	F67 W115 F120 M122 F123 W157 G161 F162 V175 Y177 H182	F67 W115 F120 M122 F123 W157 G161 F162 V175 Y177 H182

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1jgw, PDBe:1jgw, PDBj:1jgw
PDBsum	1jgw
PubMed	11526320
UniProt	P0C0Y9\|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]