Structure of PDB 1fnq Chain M

Receptor sequence

>1fnqM (length=302) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

AEYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNP
FHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
HG

3D structure

PDB

1fnq X-ray structure analyses of photosynthetic reaction center variants from Rhodobacter sphaeroides: structural changes induced by point mutations at position L209 modulate electron and proton transfer.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	M	G203 I206 A207 Y210	G203 I206 A207 Y210
BS02	BPH	M	Y210 A213 L214 M218	Y210 A213 L214 M218
BS03	FE	M	H219 E234 H266	H219 E234 H266
BS04	BCL	M	H182 L183	H182 L183
BS05	BCL	M	M122 L156 T186 N187 S190 L196 F197 H202 S205 I206 Y210 G280 I284	M122 L156 T186 N187 S190 L196 F197 H202 S205 I206 Y210 G280 I284
BS06	BPH	M	G63 F67 W129 A149 F150 A153 T277	G63 F67 W129 A149 F150 A153 T277
BS07	U10	M	M218 H219 T222 A248 A249 W252 M256 N259 A260 I265 W268	M218 H219 T222 A248 A249 W252 M256 N259 A260 I265 W268
BS08	SPO	M	F67 F68 I70 G71 W75 S119 W157 G161 F162 W171 H182	F67 F68 I70 G71 W75 S119 W157 G161 F162 W171 H182

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1fnq, PDBe:1fnq, PDBj:1fnq
PDBsum	1fnq
PubMed	11284681
UniProt	P0C0Y9\|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]