Structure of PDB 1fnp Chain M

Receptor sequence

>1fnpM (length=301) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

EYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIY
LGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPEY
GLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFL
SAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNPF
HGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAALF
WRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQNH
G

3D structure

PDB

1fnp X-ray structure analyses of photosynthetic reaction center variants from Rhodobacter sphaeroides: structural changes induced by point mutations at position L209 modulate electron and proton transfer.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	M	G202 I205 A206 Y209	G202 I205 A206 Y209
BS02	BPH	M	Y209 A212 L213 M217 W251	Y209 A212 L213 M217 W251
BS03	FE	M	H218 E233 H265	H218 E233 H265
BS04	BCL	M	H181 L182 T185	H181 L182 T185
BS05	BCL	M	M121 L155 W156 T185 N186 S189 L195 F196 H201 S204 I205 Y209 V275 G279 I283	M121 L155 W156 T185 N186 S189 L195 F196 H201 S204 I205 Y209 V275 G279 I283
BS06	BPH	M	G62 F66 W128 A148 F149 A152 T276	G62 F66 W128 A148 F149 A152 T276
BS07	U10	M	M217 H218 T221 A247 A248 W251 M255 N258 A259 I264 W267	M217 H218 T221 A247 A248 W251 M255 N258 A259 I264 W267
BS08	SPO	M	F66 F67 I69 G70 W74 S118 F119 F122 W156 G160 F161 H181	F66 F67 I69 G70 W74 S118 F119 F122 W156 G160 F161 H181

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1fnp, PDBe:1fnp, PDBj:1fnp
PDBsum	1fnp
PubMed	11284681
UniProt	P0C0Y9\|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]