Structure of PDB 1f6n Chain M

Receptor sequence

>1f6nM (length=302) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

AEYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNP
FHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
HG

3D structure

PDB

1f6n X-ray structure analyses of photosynthetic reaction center variants from Rhodobacter sphaeroides: structural changes induced by point mutations at position L209 modulate electron and proton transfer.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	M	H182 L183	H182 L183
BS02	BCL	M	G203 I206 A207 Y210	G203 I206 A207 Y210
BS03	BPH	M	Y210 A213 L214 M218	Y210 A213 L214 M218
BS04	FE	M	H219 E234 H266	H219 E234 H266
BS05	BCL	M	M122 L156 W157 T186 N187 F189 S190 L196 F197 H202 S205 I206 Y210 G280 I284	M122 L156 W157 T186 N187 F189 S190 L196 F197 H202 S205 I206 Y210 G280 I284
BS06	BPH	M	G63 F67 W129 A149 F150 A153 T277	G63 F67 W129 A149 F150 A153 T277
BS07	U10	M	M218 H219 T222 A248 A249 W252 M256 N259 A260 I265 W268	M218 H219 T222 A248 A249 W252 M256 N259 A260 I265 W268
BS08	SPO	M	F67 I70 W75 S119 F123 W157 G161 F162 H182	F67 I70 W75 S119 F123 W157 G161 F162 H182

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1f6n, PDBe:1f6n, PDBj:1f6n
PDBsum	1f6n
PubMed	11284681
UniProt	P0C0Y9\|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]