Structure of PDB 1dxr Chain M

Receptor sequence

>1dxrM (length=323) Species: 1079 (Blastochloris viridis) [Search protein sequence]

ADYQTIYTQIQARGPHITVSGEWGDNDRVGKPFYSYWLGKIGDAQIGPIY
LGASGIAAFAFGSTAILIILFNMAAEVHFDPLQFFRQFFWLGLYPPKAQY
GMGIPPLHDGGWWLMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAA
AIFFVLCIGCIHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWH
GFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRGTAVERAALFW
RWTIGFNATIESVHRWGWFFSLMVMVSASVGILLTGTFVDNWYLWCVKHG
AAPDYPAYLPATPDPASLPGAPK

3D structure

PDB

1dxr Structural basis of the drastically increased initial electron transfer rate in the reaction center from a Rhodopseudomonas viridis mutant described at 2.00-A resolution.

Chain

Resolution

2.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCB	M	G201 I204 G205 Y208	G201 I204 G205 Y208
BS02	BPB	M	Y208 L212 W250	Y208 L212 W250
BS03	FE2	M	H217 E232 H264	H217 E232 H264
BS04	MQ9	M	H217 T220 W250 F256 A258 I260 V263 W266	H217 T220 W250 F256 A258 I260 V263 W266
BS05	BCB	M	F154 I177 H180 I181 L184	F154 I177 H180 I181 L184
BS06	BCB	M	M120 F154 V155 L184 S188 F194 Y195 H200 S203 I204 Y208 M275 A278	M120 F154 V155 L184 S188 F194 Y195 H200 S203 I204 Y208 M275 A278
BS07	BPB	M	F59 S123 W127 N147 F148 S271	F59 S123 W127 N147 F148 S271
BS08	NS5	M	F88 G117 T121 G159 C160 W169 V173 G176 H180	F88 G117 T121 G159 C160 W169 V173 G176 H180

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1dxr, PDBe:1dxr, PDBj:1dxr
PDBsum	1dxr
PubMed	11005826
UniProt	P06010\|RCEM_BLAVI Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]