Structure of PDB 1aig Chain M

Receptor sequence

>1aigM (length=299) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

YQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIYL
GSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPEYG
LSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFLS
AIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNPFH
GLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAALFW
RWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQNH

3D structure

PDB

1aig Light-induced structural changes in photosynthetic reaction center: implications for mechanism of electron-proton transfer.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	M	I206 Y210 L214	I204 Y208 L212
BS02	BPH	M	W129 A149 F150 A153 T277	W127 A147 F148 A151 T275
BS03	BPH	M	Y210 A213 L214 M218 W252	Y208 A211 L212 M216 W250
BS04	FE2	M	H219 E234 H266	H217 E232 H264
BS05	BCL	M	L160 H182 L183 T186	L158 H180 L181 T184
BS06	BCL	M	A153 L156 T186 N187 F189 L196 F197 H202 S205 I206 Y210 V276 G280 I284	A151 L154 T184 N185 F187 L194 F195 H200 S203 I204 Y208 V274 G278 I282
BS07	U10	M	L215 M218 H219 T222 A248 A249 W252 M256 F258 N259 A260 T261 I265 W268	L213 M216 H217 T220 A246 A247 W250 M254 F256 N257 A258 T259 I263 W266

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1aig, PDBe:1aig, PDBj:1aig
PDBsum	1aig
PubMed	9115209
UniProt	P0C0Y9\|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]