Structure of PDB 8k2a Chain Ly

Receptor sequence
>8k2aLy (length=97) Species: 9606 (Homo sapiens) [Search protein sequence]
IGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLR
GWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR
3D structure
PDB8k2a Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainLy
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ly I32 I34 R35 L36 R46 R51 F66 K68 H69 R75 P77 W79 N86 R93 K94 R95 H108 K112 R115 Y116 Y118 H120 F121 R123 H124 K126 F127 I1 I3 R4 L5 R15 R20 F35 K37 H38 R44 P46 W48 N55 R62 K63 R64 H77 K81 R84 Y85 Y87 H89 F90 R92 H93 K95 F96
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k2a, PDBe:8k2a, PDBj:8k2a
PDBsum8k2a
PubMed38942792
UniProtQ4U2R6|RM51_HUMAN Large ribosomal subunit protein mL51 (Gene Name=MRPL51)

[Back to BioLiP]