Structure of PDB 8k2a Chain Lu

Receptor sequence

>8k2aLu (length=176) Species: 9606 (Homo sapiens) [Search protein sequence]

GLEEFFDDPKNWGQEKVKSGAAWTCQQLRNKSNEDLHKLWYVLLKERNML
LTLEQEAKRQRLPMPSPERLDKVVDSMDALDKVVQEREDALRLLQTGQER
ARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRYNRKRFFALPYVDHFLRLE
REKRARIKARKENLERKKAKILLKKF

3D structure

PDB

8k2a Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lu	Q117 K120 R121 R123 R162 R164 W168 D171 I176 W178 K180 K182 I186 H189 L190 K192 R193 N195 R196 K197 R198 F200 L202 P203 R213 R216 R222 N225 L226 R228 K229 K230 K232	Q55 K58 R59 R61 R100 R102 W106 D109 I114 W116 K118 K120 I124 H127 L128 K130 R131 N133 R134 K135 R136 F138 L140 P141 R151 R154 R160 N163 L164 R166 K167 K168 K170

Gene Ontology

	Molecular Function
GO:0003674	molecular_function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0008150	biological_process
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8k2a, PDBe:8k2a, PDBj:8k2a
PDBsum	8k2a
PubMed	38942792
UniProt	Q9HD33\|RM47_HUMAN Large ribosomal subunit protein uL29m (Gene Name=MRPL47)

[Back to BioLiP]