Structure of PDB 8yop Chain Lt

Receptor sequence
>8yopLt (length=141) Species: 9606 (Homo sapiens) [Search protein sequence]
PNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGL
RITVKLTIQNRQAQIEVVPSASALIIKALKEITFDEIVNIARQMRHRSLA
RELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECP
3D structure
PDB8yop Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainLt
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Lt R16 C17 S26 A77 S78 K83 L121 A122 R123 E124 T128 E131 I132 T135 A136 R10 C11 S20 A71 S72 K77 L99 A100 R101 E102 T106 E109 I110 T113 A114
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8yop, PDBe:8yop, PDBj:8yop
PDBsum8yop
PubMed38942792
UniProtP30050|RL12_HUMAN Large ribosomal subunit protein uL11 (Gene Name=RPL12)

[Back to BioLiP]