Structure of PDB 7zjw Chain Lt

Receptor sequence
>7zjwLt (length=115) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
DRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVL
MGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLA
NLIIQQVFDNGSIYN
3D structure
PDB7zjw Structure of the mammalian ribosome as it decodes the selenocysteine UGA codon.
ChainLt
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Lt S37 M55 G56 K57 K63 G84 S33 M51 G52 K53 K59 G80
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0014069 postsynaptic density
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:0098794 postsynapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zjw, PDBe:7zjw, PDBj:7zjw
PDBsum7zjw
PubMed35709277
UniProtG1SPK4|RLA0_RABIT Large ribosomal subunit protein uL10 (Gene Name=RPLP0)

[Back to BioLiP]