Structure of PDB 8xsz Chain Ls

Receptor sequence

>8xszLs (length=196) Species: 9606 (Homo sapiens)

DRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVL
MGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLA
NKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEI
LSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIYN

3D structure

• PDB: 8xsz Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: Ls
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ls	R6 W9 K10 Y13 F14 K16 D33 N34 V35 G36 S37 K38 Q41 R44 L54 M55 K57 N58 T59 M60 K63 H68 R83 G84 R112	R2 W5 K6 Y9 F10 K12 D29 N30 V31 G32 S33 K34 Q37 R40 L50 M51 K53 N54 T55 M56 K59 H64 R79 G80 R108

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0070180 large ribosomal subunit rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0005925 focal adhesion
• GO:0014069 postsynaptic density
• GO:0016020 membrane
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:0036464 cytoplasmic ribonucleoprotein granule
• GO:0070062 extracellular exosome
• GO:0098794 postsynapse
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8xsz, PDBe:8xsz, PDBj:8xsz
• PDBsum: 8xsz
• PubMed: 38942792
• UniProt: P05388|RLA0_HUMAN Large ribosomal subunit protein uL10 (Gene Name=RPLP0)