Structure of PDB 8k2c Chain Ls

Receptor sequence
>8k2cLs (length=196) Species: 9606 (Homo sapiens) [Search protein sequence]
DRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVL
MGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLA
NKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEI
LSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIYN
3D structure
PDB8k2c Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainLs
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ls R6 W9 K10 Y13 F14 K16 D33 G36 S37 K38 Q41 R44 M55 K57 N58 T59 K63 G84 R112 R2 W5 K6 Y9 F10 K12 D29 G32 S33 K34 Q37 R40 M51 K53 N54 T55 K59 G80 R108
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:0070062 extracellular exosome
GO:0098794 postsynapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k2c, PDBe:8k2c, PDBj:8k2c
PDBsum8k2c
PubMed38942792
UniProtP05388|RLA0_HUMAN Large ribosomal subunit protein uL10 (Gene Name=RPLP0)

[Back to BioLiP]