Structure of PDB 7bhp Chain Lr

Receptor sequence

>7bhpLr (length=122) Species: 9606 (Homo sapiens) [Search protein sequence]

SAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGV
EPAADGKGVVVVIKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNK
YRPDLRMAAIRRASAILRSQKP

3D structure

PDB

7bhp Dynamic association of human Ebp1 with the ribosome.

Chain

Resolution

3.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lr	W7 R11 N12 S15 K19 R20 N21 K22 Q23 T24 K33 S37 F38 R39 R46 R66 R67 S68 R71 K84 R87 S92 R94 H95 M96 R98 K99 D105 R107 M108 R112	W6 R10 N11 S14 K18 R19 N20 K21 Q22 T23 K32 S36 F37 R38 R45 R65 R66 S67 R70 K83 R86 S91 R93 H94 M95 R97 K98 D104 R106 M107 R111

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0016020	membrane
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0030425	dendrite
GO:0036464	cytoplasmic ribonucleoprotein granule
GO:0044297	cell body
GO:0045202	synapse
GO:0070062	extracellular exosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7bhp, PDBe:7bhp, PDBj:7bhp
PDBsum	7bhp
PubMed	33479117
UniProt	P46779\|RL28_HUMAN Large ribosomal subunit protein eL28 (Gene Name=RPL28)