Structure of PDB 8btd Chain Lq
Receptor sequence
| >8btdLq (length=91) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence] |
| MAKRTKKVGLTGKYGTRYGRAARKQLLKIETSQKAKYTCPFCAKDKVRRT ACGIWTCRSCSKTMAGGAYSLHTEPANAARATIRRLRLARE |
3D structure
| PDB | 8btd Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis. | ||
| Chain | Lq | ||
| Resolution | 4.9 Å | ||
| 3D structure |
|
Enzymatic activity
| Enzyme Commision number | ? |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | rna | Lq | M1 K3 R4 T5 K6 G9 L10 G12 K13 Y14 G15 T16 R17 Y18 G19 R20 A21 R23 K34 F41 K44 K46 R49 A51 C52 Y69 | M1 K3 R4 T5 K6 G9 L10 G12 K13 Y14 G15 T16 R17 Y18 G19 R20 A21 R23 K34 F41 K44 K46 R49 A51 C52 Y69 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0003735 | structural constituent of ribosome |
