Structure of PDB 8br8 Chain Lq

Receptor sequence
>8br8Lq (length=90) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]
AKRTKKVGLTGKYGTRYGRAARKQLLKIETSQKAKYTCPFCAKDKVRRTA
CGIWTCRSCSKTMAGGAYSLHTEPANAARATIRRLRLARE
3D structure
PDB8br8 Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.
ChainLq
Resolution3.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Lq A2 K3 R4 T5 K6 K7 V8 G9 L10 G12 K13 Y14 G15 T16 R17 Y18 G19 R20 A21 R23 Q33 K34 F41 C42 R48 R49 A51 Y69 A1 K2 R3 T4 K5 K6 V7 G8 L9 G11 K12 Y13 G14 T15 R16 Y17 G18 R19 A20 R22 Q32 K33 F40 C41 R47 R48 A50 Y68
BS02 rna Lq R20 R85 R19 R84
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8br8, PDBe:8br8, PDBj:8br8
PDBsum8br8
PubMed36912103
UniProtA8BN26

[Back to BioLiP]