Structure of PDB 8pvk Chain Lp

Receptor sequence

>8pvkLp (length=91) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

SKRTKKVGISGKYGTRYGASLRKLVKKQEVTQHARYTCTFCGKNSVRRTA
VGIWSCKSCKKTMAGGAYTVSTPAAAAMRSTLRRLREITEA

3D structure

PDB

8pvk Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.

Chain

Resolution

2.55 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Lp	S2 K3 R4 T5 K6 K7 V8 G9 I10 G12 K13 Y14 G15 T16 R17 Y18 G19 A20 R23 H34 R36 F41 C42 K44 R48 R49 T50 V52 K58 K62	S1 K2 R3 T4 K5 K6 V7 G8 I9 G11 K12 Y13 G14 T15 R16 Y17 G18 A19 R22 H33 R35 F40 C41 K43 R47 R48 T49 V51 K57 K61
BS02	ZN	Lp	C39 C42 C57 C60	C38 C41 C56 C59

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links