Structure of PDB 8pv8 Chain Lp

Receptor sequence
>8pv8Lp (length=91) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]
SKRTKKVGISGKYGTRYGASLRKLVKKQEVTQHARYTCTFCGKNSVRRTA
VGIWSCKSCKKTMAGGAYTVSTPAAAAMRSTLRRLREITEA
3D structure
PDB8pv8 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
ChainLp
Resolution2.91 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Lp S2 K3 R4 T5 K6 K7 V8 G9 I10 K13 Y14 T16 R17 Y18 G19 A20 S21 R23 Q33 H34 F41 C42 K44 R48 R49 T50 A51 V52 Y69 S1 K2 R3 T4 K5 K6 V7 G8 I9 K12 Y13 T15 R16 Y17 G18 A19 S20 R22 Q32 H33 F40 C41 K43 R47 R48 T49 A50 V51 Y68
BS02 ZN Lp C39 C42 C57 C60 C38 C41 C56 C59
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pv8, PDBe:8pv8, PDBj:8pv8
PDBsum8pv8
PubMed37921038
UniProtG0S6B0

[Back to BioLiP]