Structure of PDB 8k2a Chain Lp

Receptor sequence
>8k2aLp (length=97) Species: 9606 (Homo sapiens) [Search protein sequence]
TYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRDQVLKTR
LEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR
3D structure
PDB8k2a Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainLp
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Lp K120 H121 Y124 P125 H126 G127 R128 Y129 H130 R133 K134 P139 K75 H76 Y79 P80 H81 G82 R83 Y84 H85 R88 K89 P94
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k2a, PDBe:8k2a, PDBj:8k2a
PDBsum8k2a
PubMed38942792
UniProtQ9Y6G3|RM42_HUMAN Large ribosomal subunit protein mL42 (Gene Name=MRPL42)

[Back to BioLiP]