Structure of PDB 7zw0 Chain Lp

Receptor sequence
>7zw0Lp (length=52) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]
IIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRPKKK
LK
3D structure
PDB7zw0 Sensing of individual stalled 80S ribosomes by Fap1 for nonfunctional rRNA turnover.
ChainLp
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Lp R97 Y100 R102 R106 N109 R111 K112 R113 K114 G116 H117 N119 R122 K124 K125 R21 Y24 R26 R30 N33 R35 K36 R37 K38 G40 H41 N43 R46 K48 K49
BS02 ZN Lp C96 C99 C110 C115 C20 C23 C34 C39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zw0, PDBe:7zw0, PDBj:7zw0
PDBsum7zw0
PubMed36113412
UniProtP0CH08|RL40A_YEAST Ubiquitin-ribosomal protein eL40A fusion protein (Gene Name=RPL40A)

[Back to BioLiP]