Structure of PDB 7z3n Chain Lp

Receptor sequence
>7z3nLp (length=91) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]
SKRTKKVGISGKYGTRYGASLRKLVKKQEVTQHARYTCTFCGKNSVRRTA
VGIWSCKSCKKTMAGGAYTVSTPAAAAMRSTLRRLREITEA
3D structure
PDB7z3n Structural inventory of cotranslational protein folding by the eukaryotic RAC complex.
ChainLp
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Lp S2 R4 T5 K6 K7 V8 G9 I10 K13 T16 R17 A20 S21 R23 H34 C42 K44 R48 R49 T50 V52 S1 R3 T4 K5 K6 V7 G8 I9 K12 T15 R16 A19 S20 R22 H33 C41 K43 R47 R48 T49 V51
BS02 ZN Lp C39 C42 C57 C38 C41 C56
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7z3n, PDBe:7z3n, PDBj:7z3n
PDBsum7z3n
PubMed37081320
UniProtG0S6B0

[Back to BioLiP]