Structure of PDB 7old Chain Lp

Receptor sequence
>7oldLp (length=91) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]
SKRTKKVGISGKYGTRYGASLRKLVKKQEVTQHARYTCTFCGKNSVRRTA
VGIWSCKSCKKTMAGGAYTVSTPAAAAMRSTLRRLREITEA
3D structure
PDB7old High-resolution structures of a thermophilic eukaryotic 80S ribosome reveal atomistic details of translocation.
ChainLp
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Lp S2 R4 T5 K6 V8 I10 T16 R17 Y18 G19 A20 S21 R23 H34 R36 C42 K44 T50 V52 S1 R3 T4 K5 V7 I9 T15 R16 Y17 G18 A19 S20 R22 H33 R35 C41 K43 T49 V51
BS02 ZN Lp C39 C42 C57 C60 C38 C41 C56 C59
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7old, PDBe:7old, PDBj:7old
PDBsum7old
PubMed35079002
UniProtG0S6B0

[Back to BioLiP]