Structure of PDB 8rxh Chain Lo

Receptor sequence

>8rxhLo (length=89) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

AKRTVKMGVMGRYGTRYGANPRKRAKKLEVSQHAKHFCSFCGKFAFRRKA
VGIWRCDGCSKTVAGGAYTLSTPNNSTVRSTVRRLRELA

3D structure

PDB

8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.93 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Lo	A2 R4 T5 G9 G12 R13 Y14 R17 Y18	A1 R3 T4 G8 G11 R12 Y13 R16 Y17
BS02	rna	Lo	T5 V6 K7 M8 G15 T16 Y18 G19 A20 N21 P22 R23 F41 K62 R87	T4 V5 K6 M7 G14 T15 Y17 G18 A19 N20 P21 R22 F40 K61 R86
BS03	rna	Lo	H34 C42 K44 R49 K50 A51 R56 Y69	H33 C41 K43 R48 K49 A50 R55 Y68

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links