Structure of PDB 8rxx Chain Ln

Receptor sequence

>8rxxLn (length=33) Species: 347515 (Leishmania major strain Friedlin)

GTVSRPRGMRPKWHKKRIKRLKLRRRRMRQRSK

3D structure

• PDB: 8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
• Chain: Ln
• Resolution: 2.97 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ln	R28 R32	R27 R31
BS02	rna	Ln	G2 T3 V4 S5 R6 P7 G9 M10 R11 P12 K13 W14 H15 K16 K17 R18 K20 R21 L22 K23 R26 R27 M29 R30 S33	G1 T2 V3 S4 R5 P6 G8 M9 R10 P11 K12 W13 H14 K15 K16 R17 K19 R20 L21 K22 R25 R26 M28 R29 S32

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 18:37:42 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8rxx', asym_id = 'Ln', title = 'Structural and mechanistic insights into the fun...some lacking a single pseudouridine modification.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8rxx', asym_id='Ln', title='Structural and mechanistic insights into the fun...some lacking a single pseudouridine modification.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '8rxx', asym_id = 'Ln'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='8rxx', asym_id='Ln')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>