Structure of PDB 8oo0 Chain Ll

Receptor sequence
>8oo0Ll (length=50) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence]
PSHKTFRIKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGL
3D structure
PDB8oo0 Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.
ChainLl
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ll P2 S3 H4 K5 K10 L13 R42 W44 R48 L49 P1 S2 H3 K4 K9 L12 R41 W43 R47 L48
BS02 rna Ll F7 K12 K15 Q19 I23 W26 L29 T31 F6 K11 K14 Q18 I22 W25 L28 T30
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oo0, PDBe:8oo0, PDBj:8oo0
PDBsum8oo0
PubMed38267453
UniProtQ2H9R2

[Back to BioLiP]