Structure of PDB 7zjw Chain Ll

Receptor sequence
>7zjwLl (length=102) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
ALRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFA
PYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSSVLAAMRKAA
AK
3D structure
PDB7zjw Structure of the mammalian ribosome as it decodes the selenocysteine UGA codon.
ChainLl
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ll R4 G14 H15 V17 R25 H26 S27 R28 R29 R30 G31 R32 L33 T34 R41 Y53 R68 K74 R76 V77 G78 H80 R82 K84 R85 K86 E89 R3 G13 H14 V16 R24 H25 S26 R27 R28 R29 G30 R31 L32 T33 R40 Y52 R67 K73 R75 V76 G77 H79 R81 K83 R84 K85 E88
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zjw, PDBe:7zjw, PDBj:7zjw
PDBsum7zjw
PubMed35709277
UniProtA0A1S3FQR5

[Back to BioLiP]