Structure of PDB 6t7t Chain Ll

Receptor sequence
>6t7tLl (length=50) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
AAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKRRNWRRTKMNI
3D structure
PDB6t7t Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.
ChainLl
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ll F7 K12 K15 K18 Q19 R21 L23 W26 I27 R30 T31 K40 F6 K11 K14 K17 Q18 R20 L22 W25 I26 R29 T30 K39
BS02 rna Ll A2 A3 Q4 K5 K10 M13 K17 P22 R36 Y37 R41 R42 W44 R45 K48 M49 A1 A2 Q3 K4 K9 M12 K16 P21 R35 Y36 R40 R41 W43 R44 K47 M48
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6t7t, PDBe:6t7t, PDBj:6t7t
PDBsum6t7t
PubMed31858614
UniProtP04650|RL39_YEAST Large ribosomal subunit protein eL39 (Gene Name=RPL39)

[Back to BioLiP]