Structure of PDB 8rxh Chain Lk

Receptor sequence

>8rxhLk (length=78) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

PREIKTLKEFLAICSRKDARCVKVKHNPSATKFKVRCSRYLYTLVVNDKK
KADKIERSIHPSVKKIAVTARSHAKTNA

3D structure

PDB

8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.93 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Lk	P2 R21 K24 R37 R40 Y41 L42 K65 I67 A68 T70 R72 H74 N78	P1 R20 K23 R36 R39 Y40 L41 K64 I66 A67 T69 R71 H73 N77
BS02	rna	Lk	R17 D19 S39 R40	R16 D18 S38 R39
BS03	rna	Lk	P2 R3 E4 K24 K26 N28 K33 K35 T44 V69 S73 N78	P1 R2 E3 K23 K25 N27 K32 K34 T43 V68 S72 N77

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0022618	protein-RNA complex assembly

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0031981	nuclear lumen
GO:0097014	ciliary plasm
GO:1990904	ribonucleoprotein complex

External links