Structure of PDB 8pvk Chain Lk

Receptor sequence
>8pvkLk (length=76) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]
PQEVSDIKKFIEICRRKDASSARIKKNPKTQQIKFKVRCQRFLYTLVLKD
SDKAEKLKQSLPPNLQIKDVPKRNKR
3D structure
PDB8pvk Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
ChainLk
Resolution2.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Lk P2 E4 R17 D19 R24 K26 K35 K37 R39 Q41 R42 F43 L44 T46 V71 K73 R74 N75 K76 R77 P1 E3 R16 D18 R23 K25 K34 K36 R38 Q40 R41 F42 L43 T45 V70 K72 R73 N74 K75 R76
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Dec 2 23:47:22 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8pvk', asym_id = 'Lk', title = 'Structural insights into coordinating 5S RNP rot...TS2 pre-RNA processing during ribosome formation.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8pvk', asym_id='Lk', title='Structural insights into coordinating 5S RNP rot...TS2 pre-RNA processing during ribosome formation.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '8pvk', asym_id = 'Lk'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='8pvk', asym_id='Lk')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>