Structure of PDB 8pv3 Chain Lk

Receptor sequence
>8pv3Lk (length=76) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]
PQEVSDIKKFIEICRRKDASSARIKKNPKTQQIKFKVRCQRFLYTLVLKD
SDKAEKLKQSLPPNLQIKDVPKRNKR
3D structure
PDB8pv3 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
ChainLk
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Lk P2 E4 R17 K18 D19 R24 K26 K30 K35 K37 R39 Q41 R42 F43 L44 T46 V71 K73 R74 N75 R77 P1 E3 R16 K17 D18 R23 K25 K29 K34 K36 R38 Q40 R41 F42 L43 T45 V70 K72 R73 N74 R76
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0022618 protein-RNA complex assembly
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pv3, PDBe:8pv3, PDBj:8pv3
PDBsum8pv3
PubMed37921038
UniProtG0SG89

[Back to BioLiP]