Structure of PDB 8k82 Chain Lk

Receptor sequence
>8k82Lk (length=77) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AREITDIKQFLELTRRADVKTATVKINKKLNKAGKPFRQTKFKVRGSSSL
YTLVINDAGKAKKLIQSLPPTLKVNRL
3D structure
PDB8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainLk
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Lk A2 E4 R17 D19 K26 K42 K44 R46 S48 S49 S50 L51 A1 E3 R16 D18 K25 K41 K43 R45 S47 S48 S49 L50
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0022618 protein-RNA complex assembly
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k82, PDBe:8k82, PDBj:8k82
PDBsum8k82
PubMed38942792
UniProtP49167|RL38_YEAST Large ribosomal subunit protein eL38 (Gene Name=RPL38)

[Back to BioLiP]